PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000119031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 222aa    MW: 24930.2 Da    PI: 9.7346
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000119031genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.3e-33143201159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg+Hnh+
  MDP0000119031 143 LDDGYRWRKYGQKAVKNSSYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGTHNHP 201
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.3E-34129201IPR003657WRKY domain
SuperFamilySSF1182901.31E-28135202IPR003657WRKY domain
PROSITE profilePS5081129.092138203IPR003657WRKY domain
SMARTSM007745.1E-38143202IPR003657WRKY domain
PfamPF031062.1E-26144201IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEDHHQQHNS PPLTSQLPPL SLPFLLPPPS QNPPLPPPYL FTSSSSSSLM TNPPDLLDTD  60
WFSLLSGGTQ AAGWLSHDQI NNSFKPMAMV DKNISGSAGN IISEAADQEE KVGIKRKAGG  120
RMRKAAASRP RFAFQTRSTD DILDDGYRWR KYGQKAVKNS SYPRSYYRCT HHTCNVKKQV  180
QRLSKDTSIV VTTYEGTHNH PCEKLMETLA PLLKQMQFLS RF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-25133200774Probable WRKY transcription factor 4
2lex_A6e-25133200774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338781.11e-135PREDICTED: probable WRKY transcription factor 24
RefseqXP_009350324.11e-135PREDICTED: probable WRKY transcription factor 24
TrEMBLM5X3041e-84M5X304_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s16640.12e-69(Populus trichocarpa)
STRINGGLYMA16G03480.29e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-55WRKY DNA-binding protein 56